5.00 Rating by CuteStat

prevozrobe.info is 4 years 1 month old. It is a domain having info extension. It has a global traffic rank of #3830123 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, prevozrobe.info is SAFE to browse.

PageSpeed Score
100
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 220
Daily Pageviews: 440

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: 4

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 3,830,123
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

51.79.99.106

Hosted Country:

Canada CA

Location Latitude:

43.6319

Location Longitude:

-79.3716

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 51.79.99.106)

Dox.WTF

- dox.wtf
Not Applicable $ 8.95

dz-nulled

- dz-nulled.com
Not Applicable $ 8.95

Home - Affiliates 4 Wildlife

- aff4w.com

Protect The Wolves™ is building a Pack of Affiliates To help them become Internet Marketers with the Partnership to Success

Not Applicable $ 8.95

Portal Home - WHMCS Beta

- whmcsbeta.host
Not Applicable $ 8.95

Index of /

- puppurchase.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Mon, 23 Mar 2020 11:22:32 GMT
Server: Apache
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 313
Content-Type: text/html;charset=ISO-8859-1

Domain Information

Domain Registrar: FrontStreetDomains.com LLC
Registration Date: Mar 13, 2020, 12:45 PM 4 years 1 month 1 week ago
Expiration Date: Mar 13, 2021, 12:45 PM 3 years 1 month 2 weeks ago
Domain Status:
clienttransferprohibited

Domain Nameserver Information

Host IP Address Country
ns01.serverencryption.net 169.46.164.206 United States of America United States of America
ns02.serverencryption.net 192.99.78.145 Canada Canada

DNS Record Analysis

Host Type TTL Extra
prevozrobe.info A 10800 IP: 51.79.99.106
prevozrobe.info NS 86400 Target: ns01.serverencryption.net
prevozrobe.info NS 86400 Target: ns02.serverencryption.net
prevozrobe.info SOA 10800 MNAME: ns01.serverencryption.net
RNAME: admin.mkwdevelopment.com
Serial: 2020031302
Refresh: 3600
Retry: 1800
Expire: 1209600
Minimum TTL: 86400
prevozrobe.info MX 14400 Target: prevozrobe.info
prevozrobe.info TXT 14400 TXT: v=spf1 +a +mx +ip4:51.79.99.106 ~all

Similarly Ranked Websites

esoportunidade.com -&nbspesoportunidade Resources and Information.

- esoportunidade.com

esoportunidade.com is your first and best source for all of the information you’re looking for. From general topics to more of what you would expect to find here, esoportunidade.com has it all. We hope you find what you are searching for!

3,830,126 $ 240.00

Log In

- lender.ihfa.org
3,830,126 $ 240.00

The Athletics Federation of Nigeria | AFN

- athleticsnigeria.org

The Athletics Federation of Nigeria (AFN) is the governing body for the sport of track and field Athletics in Nigeria, West Africa.

3,830,128 $ 240.00

WordPress-Gear

- wpgear.org
3,830,135 $ 240.00

404 Not Found

- watchintenselyspeedythefile.vip
3,830,141 $ 240.00

Full WHOIS Lookup

Domain Name: prevozrobe.info
Registry Domain ID: D503300001183520028-LRMS
Registrar WHOIS Server: whois.namesilo.com
Registrar URL: https://www.namesilo.com/
Updated Date: 2020-03-14T07:00:00Z
Creation Date: 2020-03-13T07:00:00Z
Registrar Registration Expiration Date: 2021-03-13T07:00:00Z
Registrar: NameSilo, LLC
Registrar IANA ID: 1479
Registrar Abuse Contact Email: abuse@namesilo.com
Registrar Abuse Contact Phone: +1.4805240066
Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: Domain Administrator
Registrant Organization: See PrivacyGuardian.org
Registrant Street: 1928 E. Highland Ave. Ste F104 PMB# 255
Registrant City: Phoenix
Registrant State/Province: AZ
Registrant Postal Code: 85016
Registrant Country: US
Registrant Phone: +1.3478717726
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: pw-9e6abfa71dcd5e5d935908f1ce561c5c@privacyguardian.org
Registry Admin ID:
Admin Name: Domain Administrator
Admin Organization: See PrivacyGuardian.org
Admin Street: 1928 E. Highland Ave. Ste F104 PMB# 255
Admin City: Phoenix
Admin State/Province: AZ
Admin Postal Code: 85016
Admin Country: US
Admin Phone: +1.3478717726
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: pw-9e6abfa71dcd5e5d935908f1ce561c5c@privacyguardian.org
Registry Tech ID:
Tech Name: Domain Administrator
Tech Organization: See PrivacyGuardian.org
Tech Street: 1928 E. Highland Ave. Ste F104 PMB# 255
Tech City: Phoenix
Tech State/Province: AZ
Tech Postal Code: 85016
Tech Country: US
Tech Phone: +1.3478717726
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: pw-9e6abfa71dcd5e5d935908f1ce561c5c@privacyguardian.org
Name Server: NS01.SERVERENCRYPTION.NET
Name Server: NS02.SERVERENCRYPTION.NET
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-03-23T07:00:00Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

NOTICE AND TERMS OF USE: You are not authorized to access or query our WHOIS
database through the use of high-volume, automated, electronic processes. The
Data in our WHOIS database is provided for information purposes only, and to
assist persons in obtaining information about or related to a domain name
registration record. We do not guarantee its accuracy. By submitting a WHOIS
query, you agree to abide by the following terms of use: You agree that you may
use this Data only for lawful purposes and that under no circumstances will you
use this Data to: (1) allow, enable, or otherwise support the transmission of
mass unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes that
apply to us (or our computer systems). The compilation, repackaging,
dissemination or other use of this Data is expressly prohibited without our
prior written consent. We reserve the right to terminate your access to the
WHOIS database at our sole discretion, including without limitation, for
excessive querying of the WHOIS database or for failure to otherwise abide by
this policy. We reserve the right to modify these terms at any time.

Domains - cheap, easy, and secure at NameSilo.com

https://www.namesilo.com

Register your domain now at www.NameSilo.com - Domains. Cheap, Fast and Secure